MAU2/KIAA0892 Antikörper (Middle Region)

Produktnummer ABIN632809

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MAU2/KIAA0892 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für MAU2/KIAA0892 Antikörper (Middle Region) (ABIN632809)

Target: MAU2/KIAA0892 (MAU2) (MAU2 Sister Chromatid Cohesion Factor (MAU2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAU2/KIAA0892 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAU2/KIAA0892 Antikörper

Bindungsspezifität: Middle Region

Spezifität: KIAA0892 antibody was raised against the middle region of KIAA0892

Aufreinigung: Affinity purified

Immunogen: KIAA0892 antibody was raised using the middle region of KIAA0892 corresponding to a region with amino acids MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA0892 Blocking Peptide, (ABIN5614332), is also available for use as a blocking control in assays to test for specificity of this KIAA0892 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0892 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAU2/KIAA0892

Target: MAU2/KIAA0892 (MAU2) (MAU2 Sister Chromatid Cohesion Factor (MAU2))

Andere Bezeichnung: KIAA0892

Hintergrund: KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.

Molekulargewicht: 69 kDa (MW of target protein)