ZCCHC14 Antikörper (N-Term)

Produktnummer ABIN632807

Produktdetails anti-ZCCHC14 Antikörper

Target: ZCCHC14 (Zinc Finger, CCHC Domain Containing 14 (ZCCHC14))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZCCHC14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZCCHC14 antibody was raised against the N terminal of ZCCHC14

Aufreinigung: Affinity purified

Immunogen: ZCCHC14 antibody was raised using the N terminal of ZCCHC14 corresponding to a region with amino acids RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZCCHC14 Blocking Peptide, catalog no. 33R-8278, is also available for use as a blocking control in assays to test for specificity of this ZCCHC14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZCCHC14

Target: ZCCHC14 (Zinc Finger, CCHC Domain Containing 14 (ZCCHC14))

Andere Bezeichnung: ZCCHC14 (ZCCHC14 Produkte)

Synonyme: MGC131346 antikoerper, BDG-29 antikoerper, BDG29 antikoerper, AA792890 antikoerper, RGD1309494 antikoerper, zinc finger CCHC-type containing 14 antikoerper, zinc finger CCHC-type containing 14 L homeolog antikoerper, zinc finger CCHC domain-containing protein 14 antikoerper, zinc finger, CCHC domain containing 14 antikoerper, ZCCHC14 antikoerper, zcchc14.L antikoerper, LOC100082786 antikoerper, zcchc14 antikoerper, LOC100539002 antikoerper, Zcchc14 antikoerper

Hintergrund: ZCCHC14 contains 1 CCHC-type zinc finger. The function of ZCCHC14 remains unknown.

Molekulargewicht: 100 kDa (MW of target protein)