R3HDM2 Antikörper (Middle Region)

Produktnummer ABIN632805

Dieses Anti-R3HDM2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von R3HDM2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für R3HDM2 Antikörper (Middle Region) (ABIN632805)

Target: R3HDM2 (R3H Domain Containing 2 (R3HDM2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser R3HDM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-R3HDM2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: R3 HDM2 antibody was raised against the middle region of R3 DM2

Aufreinigung: Affinity purified

Immunogen: R3 HDM2 antibody was raised using the middle region of R3 DM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

R3HDM2 Blocking Peptide, (ABIN5615696), is also available for use as a blocking control in assays to test for specificity of this R3HDM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of R0 DM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu R3HDM2

Target: R3HDM2 (R3H Domain Containing 2 (R3HDM2))

Andere Bezeichnung: R3HDM2

Hintergrund: R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.

Molekulargewicht: 68 kDa (MW of target protein)