AKR7A3 Antikörper
-
- Target Alle AKR7A3 Antikörper anzeigen
- AKR7A3 (Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AKR7A3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- AKR7 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW
- Top Product
- Discover our top product AKR7A3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AKR7A3 Blocking Peptide, catalog no. 33R-9513, is also available for use as a blocking control in assays to test for specificity of this AKR7A3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AKR7A3 (Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3))
- Andere Bezeichnung
- AKR7A3 (AKR7A3 Produkte)
- Synonyme
- AFAR2 antikoerper, fd56g11 antikoerper, wu:fd56g11 antikoerper, zgc:92502 antikoerper, AKR7A2 antikoerper, Afar antikoerper, Akr7a1 antikoerper, aldo-keto reductase family 7 member A3 antikoerper, aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase) antikoerper, aflatoxin B1 aldehyde reductase member 3 antikoerper, AKR7A3 antikoerper, akr7a3 antikoerper, LOC788425 antikoerper, Akr7a3 antikoerper
- Hintergrund
- Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.
- Molekulargewicht
- 37 kDa (MW of target protein)
-