C12orf40 Antikörper (N-Term)

Produktnummer ABIN632785

Produktdetails anti-C12orf40 Antikörper

Target: C12orf40 (Chromosome 12 Open Reading Frame 40 (C12orf40))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C12orf40 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C12 ORF40 antibody was raised against the N terminal Of C12 rf40

Aufreinigung: Affinity purified

Immunogen: C12 ORF40 antibody was raised using the N terminal Of C12 rf40 corresponding to a region with amino acids ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C12ORF40 Blocking Peptide, catalog no. 33R-2601, is also available for use as a blocking control in assays to test for specificity of this C12ORF40 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C12orf40

Target: C12orf40 (Chromosome 12 Open Reading Frame 40 (C12orf40))

Andere Bezeichnung: C12ORF40 (C12orf40 Produkte)

Synonyme: chromosome 12 open reading frame 40 antikoerper, C12orf40 antikoerper

Hintergrund: The function of C12orf40 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 74 kDa (MW of target protein)