PGBD2 Antikörper (Middle Region)

Produktnummer ABIN632783

Der Kaninchen Polyklonal anti-PGBD2 Antikörper wird verwendet zum Nachweis von PGBD2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für PGBD2 Antikörper (Middle Region) (ABIN632783)

Target: PGBD2 (PiggyBac Transposable Element Derived 2 (PGBD2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PGBD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PGBD2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PGBD2 antibody was raised against the middle region of PGBD2

Aufreinigung: Affinity purified

Immunogen: PGBD2 antibody was raised using the middle region of PGBD2 corresponding to a region with amino acids RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGBD2 Blocking Peptide, (ABIN5615329), is also available for use as a blocking control in assays to test for specificity of this PGBD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGBD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PGBD2

Target: PGBD2 (PiggyBac Transposable Element Derived 2 (PGBD2))

Andere Bezeichnung: PGBD2

Hintergrund: The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known.

Molekulargewicht: 39 kDa (MW of target protein)