MAGEA4 Antikörper (C-Term)

Produktnummer ABIN632780

Der Kaninchen Polyklonal Anti-MAGEA4-Antikörper wurde für WB validiert. Er ist geeignet, MAGEA4 in Proben von Human zu detektieren.

Kurzübersicht für MAGEA4 Antikörper (C-Term) (ABIN632780)

Target: MAGEA4 (Melanoma Antigen Family A, 4 (MAGEA4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAGEA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAGEA4 Antikörper

Bindungsspezifität: C-Term

Spezifität: MAGEA4 antibody was raised against the C terminal of MAGEA4

Aufreinigung: Affinity purified

Immunogen: MAGEA4 antibody was raised using the C terminal of MAGEA4 corresponding to a region with amino acids ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAGEA4 Blocking Peptide, (ABIN938006), is also available for use as a blocking control in assays to test for specificity of this MAGEA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAGEA4

Target: MAGEA4 (Melanoma Antigen Family A, 4 (MAGEA4))

Andere Bezeichnung: MAGEA4

Hintergrund: MAGEA4 is a member of the MAGEA family. The members of this family are proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Molekulargewicht: 35 kDa (MW of target protein)