GOLGA7B Antikörper (N-Term)

Produktnummer ABIN632779

Produktdetails anti-GOLGA7B Antikörper

Target: GOLGA7B (Golgin A7 Family, Member B (GOLGA7B))

Bindungsspezifität: N-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GOLGA7B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C10 ORF132 antibody was raised against the N terminal Of C10 rf132

Aufreinigung: Affinity purified

Immunogen: C10 ORF132 antibody was raised using the N terminal Of C10 rf132 corresponding to a region with amino acids MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C10ORF132 Blocking Peptide, catalog no. 33R-5771, is also available for use as a blocking control in assays to test for specificity of this C10ORF132 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF132 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GOLGA7B

Target: GOLGA7B (Golgin A7 Family, Member B (GOLGA7B))

Andere Bezeichnung: C10ORF132 (GOLGA7B Produkte)

Synonyme: 4933417O08Rik antikoerper, AI839934 antikoerper, C10orf132 antikoerper, C10orf133 antikoerper, bA451M19.3 antikoerper, bA459F3.4 antikoerper, golgin A7 family, member B antikoerper, golgin A7 family, member Bb antikoerper, golgi autoantigen, golgin subfamily a, 7B antikoerper, golgin A7 family member B antikoerper, Golga7b antikoerper, golga7bb antikoerper, GOLGA7B antikoerper

Hintergrund: C10orf132 may be involved in protein transport from Golgi to cell surface (By similarity).

Molekulargewicht: 18 kDa (MW of target protein)