FAM116A Antikörper (Middle Region)
-
- Target Alle FAM116A Produkte
- FAM116A (Family with Sequence Similarity 116, Member A (FAM116A))
- Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM116A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM116 A antibody was raised against the middle region of FAM116
- Aufreinigung
- Affinity purified
- Immunogen
- FAM116 A antibody was raised using the middle region of FAM116 corresponding to a region with amino acids KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM116A Blocking Peptide, catalog no. 33R-4585, is also available for use as a blocking control in assays to test for specificity of this FAM116A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM116A (Family with Sequence Similarity 116, Member A (FAM116A))
- Andere Bezeichnung
- FAM116A (FAM116A Produkte)
- Hintergrund
- FAM116A belongs to the FAM116 family. The exact function of FAM116A remains unknown.
- Molekulargewicht
- 67 kDa (MW of target protein)
-