FAM116A Antikörper (Middle Region)

Produktnummer ABIN632778

Dieser Anti-FAM116A Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von FAM116A in WB. Geeignet für Human und Ratte.

Kurzübersicht für FAM116A Antikörper (Middle Region) (ABIN632778)

Target: FAM116A (Family with Sequence Similarity 116, Member A (FAM116A))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM116A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM116A Antikörper

Bindungsspezifität: Middle Region

Spezifität: FAM116 A antibody was raised against the middle region of FAM116

Aufreinigung: Affinity purified

Immunogen: FAM116 A antibody was raised using the middle region of FAM116 corresponding to a region with amino acids KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM116A Blocking Peptide, (ABIN939971), is also available for use as a blocking control in assays to test for specificity of this FAM116A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM116A

Target: FAM116A (Family with Sequence Similarity 116, Member A (FAM116A))

Andere Bezeichnung: FAM116A

Hintergrund: FAM116A belongs to the FAM116 family. The exact function of FAM116A remains unknown.

Molekulargewicht: 67 kDa (MW of target protein)