PRELID2 Antikörper (C-Term)

Produktnummer ABIN632775

Produktdetails anti-PRELID2 Antikörper

Target: PRELID2 (PRELI Domain Containing 2 (PRELID2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRELID2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRELID2 antibody was raised against the C terminal of PRELID2

Aufreinigung: Affinity purified

Immunogen: PRELID2 antibody was raised using the C terminal of PRELID2 corresponding to a region with amino acids GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRELID2 Blocking Peptide, catalog no. 33R-3533, is also available for use as a blocking control in assays to test for specificity of this PRELID2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRELID2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRELID2

Target: PRELID2 (PRELI Domain Containing 2 (PRELID2))

Andere Bezeichnung: PRELID2 (PRELID2 Produkte)

Synonyme: 1700003A01Rik antikoerper, C330008K14Rik antikoerper, PRELID2 antikoerper, PRELI domain containing 2 antikoerper, PRELI domain containing 2 L homeolog antikoerper, PRELID2 antikoerper, Prelid2 antikoerper, prelid2.L antikoerper

Hintergrund: PRELID2 contains 1 PRELI/MSF1 domain. The exact function of PRELID2 remains unknown.

Molekulargewicht: 22 kDa (MW of target protein)