Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

THAP5 Antikörper (Middle Region)

Der Kaninchen Polyklonal Anti-THAP5-Antikörper wurde für WB validiert. Er ist geeignet, THAP5 in Proben von Human zu detektieren.
Produktnummer ABIN632774

Kurzübersicht für THAP5 Antikörper (Middle Region) (ABIN632774)

Target

Alle THAP5 Antikörper anzeigen
THAP5 (THAP Domain Containing 5 (THAP5))

Reaktivität

  • 4
  • 2
  • 1
  • 1
  • 1
Human

Wirt

  • 3
  • 1
Kaninchen

Klonalität

  • 3
  • 1
Polyklonal

Konjugat

  • 4
Dieser THAP5 Antikörper ist unkonjugiert

Applikation

  • 4
  • 2
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 1
    • 1
    • 1
    Middle Region

    Spezifität

    THAP5 antibody was raised against the middle region of THAP5

    Aufreinigung

    Affinity purified

    Immunogen

    THAP5 antibody was raised using the middle region of THAP5 corresponding to a region with amino acids TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    THAP5 Blocking Peptide, (ABIN5616584), is also available for use as a blocking control in assays to test for specificity of this THAP5 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THAP5 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    THAP5 (THAP Domain Containing 5 (THAP5))

    Andere Bezeichnung

    THAP5

    Hintergrund

    THAP5 contains 1 THAP-type zinc finger. The exact function of THAP5 remains unknown.

    Molekulargewicht

    44 kDa (MW of target protein)
Sie sind hier:
Chat with us!