DNAJC24 Antikörper (N-Term)

Produktnummer ABIN632772

Produktdetails anti-DNAJC24 Antikörper

Target: DNAJC24 (DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNAJC24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DPH4 antibody was raised against the N terminal Of Dph4

Aufreinigung: Affinity purified

Immunogen: DPH4 antibody was raised using the N terminal Of Dph4 corresponding to a region with amino acids MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPH4 Blocking Peptide, catalog no. 33R-6225, is also available for use as a blocking control in assays to test for specificity of this DPH4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNAJC24

Target: DNAJC24 (DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24))

Andere Bezeichnung: DPH4 (DNAJC24 Produkte)

Synonyme: DPH4 antikoerper, JJJ3 antikoerper, ZCSL3 antikoerper, 1700030A21Rik antikoerper, 2610027M02Rik antikoerper, AV066965 antikoerper, AW240712 antikoerper, Dph4 antikoerper, MmDjC7 antikoerper, Zcsl3 antikoerper, RGD1564710 antikoerper, DnaJ heat shock protein family (Hsp40) member C24 antikoerper, DNAJC24 antikoerper, Dnajc24 antikoerper

Hintergrund: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.

Molekulargewicht: 17 kDa (MW of target protein)