CCDC60 Antikörper (C-Term)

Produktnummer ABIN632771

Produktdetails anti-CCDC60 Antikörper

Target: CCDC60 (Coiled-Coil Domain Containing 60 (CCDC60))

Bindungsspezifität: C-Term

Reaktivität: Ratte, Maus, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC60 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC60 antibody was raised against the C terminal of CCDC60

Aufreinigung: Affinity purified

Immunogen: CCDC60 antibody was raised using the C terminal of CCDC60 corresponding to a region with amino acids RPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC60 Blocking Peptide, catalog no. 33R-8088, is also available for use as a blocking control in assays to test for specificity of this CCDC60 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC60 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC60

Target: CCDC60 (Coiled-Coil Domain Containing 60 (CCDC60))

Andere Bezeichnung: CCDC60 (CCDC60 Produkte)

Synonyme: AU018954 antikoerper, C130098D09 antikoerper, coiled-coil domain containing 60 antikoerper, transmembrane protein 233 antikoerper, CCDC60 antikoerper, TMEM233 antikoerper, Ccdc60 antikoerper

Hintergrund: The function of CCDC60 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 63 kDa (MW of target protein)