FAM71A Antikörper (C-Term)

Produktnummer ABIN632763

Produktdetails anti-FAM71A Antikörper

Target: FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM71A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM71 A antibody was raised against the C terminal of FAM71

Aufreinigung: Affinity purified

Immunogen: FAM71 A antibody was raised using the C terminal of FAM71 corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM71A Blocking Peptide, catalog no. 33R-2019, is also available for use as a blocking control in assays to test for specificity of this FAM71A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM71A

Target: FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))

Andere Bezeichnung: FAM71A (FAM71A Produkte)

Synonyme: RGD1561646 antikoerper, GARI-L4 antikoerper, 4933417M04Rik antikoerper, RP11-338C15.4 antikoerper, family with sequence similarity 71, member A antikoerper, family with sequence similarity 71 member A antikoerper, Fam71a antikoerper, FAM71A antikoerper

Hintergrund: FAM71A belongs to the FAM71 family. The exact function of C15orf27 remains unknown.

Molekulargewicht: 63 kDa (MW of target protein)