PSTK Antikörper (Middle Region)

Produktnummer ABIN632756

Der Kaninchen Polyklonal Anti-PSTK-Antikörper wurde für WB validiert. Er ist geeignet, PSTK in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für PSTK Antikörper (Middle Region) (ABIN632756)

Target: PSTK (Phosphoseryl-tRNA Kinase (PSTK))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSTK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PSTK Antikörper

Bindungsspezifität: Middle Region

Spezifität: PSTK antibody was raised against the middle region of PSTK

Aufreinigung: Affinity purified

Immunogen: PSTK antibody was raised using the middle region of PSTK corresponding to a region with amino acids SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSTK Blocking Peptide, (ABIN5615643), is also available for use as a blocking control in assays to test for specificity of this PSTK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSTK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSTK

Target: PSTK (Phosphoseryl-tRNA Kinase (PSTK))

Andere Bezeichnung: PSTK

Hintergrund: PSTK specifically phosphorylates seryl-tRNA(Sec) to O-phosphoseryl-tRNA(Sec), an activated intermediate for selenocysteine biosynthesis.

Molekulargewicht: 39 kDa (MW of target protein)