LACC1 Antikörper (Middle Region)

Produktnummer ABIN632755

Produktdetails anti-LACC1 Antikörper

Target: LACC1 (C13orf31) (Chromosome 13 Open Reading Frame 31 (C13orf31))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LACC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C13 ORF31 antibody was raised against the middle region of C13 rf31

Aufreinigung: Affinity purified

Immunogen: C13 ORF31 antibody was raised using the middle region of C13 rf31 corresponding to a region with amino acids TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C13ORF31 Blocking Peptide, catalog no. 33R-9117, is also available for use as a blocking control in assays to test for specificity of this C13ORF31 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF31 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LACC1

Target: LACC1 (C13orf31) (Chromosome 13 Open Reading Frame 31 (C13orf31))

Andere Bezeichnung: C13ORF31 (C13orf31 Produkte)

Synonyme: C17H13orf31 antikoerper, c13orf31 antikoerper, C13orf31 antikoerper, 9030625A04Rik antikoerper, laccase domain containing 1 antikoerper, laccase (multicopper oxidoreductase) domain containing 1 L homeolog antikoerper, LACC1 laccase domain containing 1 antikoerper, laccase (multicopper oxidoreductase) domain containing 1 antikoerper, LACC1 antikoerper, lacc1.L antikoerper, Lacc1 antikoerper

Hintergrund: The function of C13orf31 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 48 kDa (MW of target protein)