IQCK Antikörper (Middle Region)

Produktnummer ABIN632754

Dieses Anti-IQCK-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von IQCK in WB. Geeignet für Human und Ratte.

Kurzübersicht für IQCK Antikörper (Middle Region) (ABIN632754)

Target: IQCK (IQ Motif Containing K (IQCK))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IQCK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IQCK Antikörper

Bindungsspezifität: Middle Region

Spezifität: IQCK antibody was raised against the middle region of IQCK

Aufreinigung: Affinity purified

Immunogen: IQCK antibody was raised using the middle region of IQCK corresponding to a region with amino acids GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IQCK Blocking Peptide, (ABIN938819), is also available for use as a blocking control in assays to test for specificity of this IQCK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IQCK

Target: IQCK (IQ Motif Containing K (IQCK))

Andere Bezeichnung: IQCK

Hintergrund: The function of IQC protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 33 kDa (MW of target protein)