NADK2 Antikörper (Middle Region)

Produktnummer ABIN632753

Der Kaninchen Polyklonal Anti-NADK2-Antikörper wurde für WB validiert. Er ist geeignet, NADK2 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für NADK2 Antikörper (Middle Region) (ABIN632753)

Target: NADK2 (NAD Kinase 2, Mitochondrial (NADK2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NADK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NADK2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C5 ORF33 antibody was raised against the middle region of C5 rf33

Aufreinigung: Affinity purified

Immunogen: C5 ORF33 antibody was raised using the middle region of C5 rf33 corresponding to a region with amino acids RWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C5ORF33 Blocking Peptide, (ABIN5612525), is also available for use as a blocking control in assays to test for specificity of this C5ORF33 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NADK2

Target: NADK2 (NAD Kinase 2, Mitochondrial (NADK2))

Andere Bezeichnung: C5ORF33

Hintergrund: The specific function of C5orf33 is not yet known.

Molekulargewicht: 49 kDa (MW of target protein)