PDIK1L Antikörper (Middle Region)

Produktnummer ABIN632750

Der Kaninchen-Polyklonal Anti-PDIK1L-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von PDIK1L in Proben aus Human, Maus und Ratte. }

Kurzübersicht für PDIK1L Antikörper (Middle Region) (ABIN632750)

Target: PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDIK1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDIK1L Antikörper

Bindungsspezifität: Middle Region

Spezifität: PDIK1 L antibody was raised against the middle region of PDIK1

Aufreinigung: Affinity purified

Immunogen: PDIK1 L antibody was raised using the middle region of PDIK1 corresponding to a region with amino acids FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDIK1L Blocking Peptide, (ABIN938256), is also available for use as a blocking control in assays to test for specificity of this PDIK1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIK0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDIK1L

Target: PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))

Andere Bezeichnung: PDIK1L

Hintergrund: The specific function of PDIK1L is not yet known.

Molekulargewicht: 38 kDa (MW of target protein)