RWDD4A Antikörper (N-Term)

Produktnummer ABIN632749

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RWDD4A in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RWDD4A Antikörper (N-Term) (ABIN632749)

Target: RWDD4A (RWDD4) (RWD Domain Containing 4 (RWDD4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RWDD4A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RWDD4A Antikörper

Bindungsspezifität: N-Term

Spezifität: RWDD4 A antibody was raised against the N terminal of RWDD4

Aufreinigung: Affinity purified

Immunogen: RWDD4 A antibody was raised using the N terminal of RWDD4 corresponding to a region with amino acids MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RWDD4A Blocking Peptide, (ABIN5615980), is also available for use as a blocking control in assays to test for specificity of this RWDD4A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RWDD4A

Target: RWDD4A (RWDD4) (RWD Domain Containing 4 (RWDD4))

Andere Bezeichnung: RWDD4A

Hintergrund: The function of RWDD4 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 21 kDa (MW of target protein)