NANP Antikörper (Middle Region)

Produktnummer ABIN632748

Produktdetails anti-NANP Antikörper

Target: NANP (N-Acetylneuraminic Acid Phosphatase (NANP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NANP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NANP antibody was raised against the middle region of NANP

Aufreinigung: Affinity purified

Immunogen: NANP antibody was raised using the middle region of NANP corresponding to a region with amino acids VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NANP Blocking Peptide, catalog no. 33R-9755, is also available for use as a blocking control in assays to test for specificity of this NANP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NANP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium Azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained staff only.

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NANP

Target: NANP (N-Acetylneuraminic Acid Phosphatase (NANP))

Andere Bezeichnung: NANP (NANP Produkte)

Synonyme: rgd1306009 antikoerper, C20orf147 antikoerper, HDHD4 antikoerper, dJ694B14.3 antikoerper, 1600031M04Rik antikoerper, Hdhd4 antikoerper, RGD1306009 antikoerper, zgc:111947 antikoerper, N-acylneuraminate-9-phosphatase antikoerper, N-acetylneuraminic acid phosphatase antikoerper, N-acetylneuraminic acid phosphatase L homeolog antikoerper, nanp antikoerper, NANP antikoerper, Nanp antikoerper, nanp.L antikoerper

Hintergrund: The function of NANP protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 28 kDa (MW of target protein)