NANP Antikörper (Middle Region)

Produktnummer ABIN632748

Dieses Anti-NANP-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NANP in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für NANP Antikörper (Middle Region) (ABIN632748)

Target: NANP (N-Acetylneuraminic Acid Phosphatase (NANP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NANP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NANP Antikörper

Bindungsspezifität: Middle Region

Spezifität: NANP antibody was raised against the middle region of NANP

Aufreinigung: Affinity purified

Immunogen: NANP antibody was raised using the middle region of NANP corresponding to a region with amino acids VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NANP Blocking Peptide, (ABIN5614910), is also available for use as a blocking control in assays to test for specificity of this NANP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NANP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium Azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained staff only.

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NANP

Target: NANP (N-Acetylneuraminic Acid Phosphatase (NANP))

Andere Bezeichnung: NANP

Hintergrund: The function of NANP protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 28 kDa (MW of target protein)