FAM76A Antikörper (N-Term)

Produktnummer ABIN632747

Der Kaninchen-Polyklonal Anti-FAM76A-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von FAM76A in Proben aus Human, Maus und Ratte. }

Kurzübersicht für FAM76A Antikörper (N-Term) (ABIN632747)

Target: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM76A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM76A Antikörper

Bindungsspezifität: N-Term

Spezifität: FAM76 A antibody was raised against the N terminal of FAM76

Aufreinigung: Affinity purified

Immunogen: FAM76 A antibody was raised using the N terminal of FAM76 corresponding to a region with amino acids MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM76A Blocking Peptide, (ABIN5613500), is also available for use as a blocking control in assays to test for specificity of this FAM76A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM76A

Target: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Andere Bezeichnung: FAM76A

Hintergrund: The specific function of FAM76A is not yet known.

Molekulargewicht: 35 kDa (MW of target protein)