C12ORF50 Antikörper (N-Term)

Produktnummer ABIN632742

Produktdetails anti-C12ORF50 Antikörper

Target: C12ORF50 (Chromosome 12 Open Reading Frame 50 (C12ORF50))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C12ORF50 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C12 ORF50 antibody was raised against the N terminal Of C12 rf50

Aufreinigung: Affinity purified

Immunogen: C12 ORF50 antibody was raised using the N terminal Of C12 rf50 corresponding to a region with amino acids INGLFLPPSSNITLQKEIQEGIPLQSQSQEPLKPQENISRPIHHPLVLKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C12ORF50 Blocking Peptide, catalog no. 33R-4072, is also available for use as a blocking control in assays to test for specificity of this C12ORF50 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C12ORF50

Target: C12ORF50 (Chromosome 12 Open Reading Frame 50 (C12ORF50))

Andere Bezeichnung: C12ORF50 (C12ORF50 Produkte)

Synonyme: C12orf50 antikoerper, MGC134438 antikoerper, chromosome 1 C12orf50 homolog antikoerper, chromosome 12 open reading frame 50 antikoerper, chromosome 5 open reading frame, human C12orf50 antikoerper, C1H12orf50 antikoerper, C12orf50 antikoerper, C5H12orf50 antikoerper

Hintergrund: The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 47 kDa (MW of target protein)