AMDHD1 Antikörper (N-Term)

Produktnummer ABIN632735

Produktdetails anti-AMDHD1 Antikörper

Target: AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AMDHD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AMDHD1 antibody was raised against the N terminal of AMDHD1

Aufreinigung: Affinity purified

Immunogen: AMDHD1 antibody was raised using the N terminal of AMDHD1 corresponding to a region with amino acids AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AMDHD1 Blocking Peptide, catalog no. 33R-1604, is also available for use as a blocking control in assays to test for specificity of this AMDHD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMDHD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AMDHD1

Target: AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))

Andere Bezeichnung: AMDHD1 (AMDHD1 Produkte)

Synonyme: RGD1308879 antikoerper, 1300019J08Rik antikoerper, amidohydrolase domain containing 1 antikoerper, amidohydrolase domain containing 1 L homeolog antikoerper, si:ch73-71d17.1 antikoerper, Amdhd1 antikoerper, AMDHD1 antikoerper, amdhd1 antikoerper, amdhd1.L antikoerper, si:ch73-71d17.1 antikoerper

Hintergrund: The function of AMDHD protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 47 kDa (MW of target protein)