AMDHD1 Antikörper (N-Term)

Produktnummer ABIN632735

Der Kaninchen Polyklonal Anti-AMDHD1-Antikörper wurde für WB validiert. Er ist geeignet, AMDHD1 in Proben von Human zu detektieren.

Kurzübersicht für AMDHD1 Antikörper (N-Term) (ABIN632735)

Target: AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AMDHD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AMDHD1 Antikörper

Bindungsspezifität: N-Term

Spezifität: AMDHD1 antibody was raised against the N terminal of AMDHD1

Aufreinigung: Affinity purified

Immunogen: AMDHD1 antibody was raised using the N terminal of AMDHD1 corresponding to a region with amino acids AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AMDHD1 Blocking Peptide, (ABIN936990), is also available for use as a blocking control in assays to test for specificity of this AMDHD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMDHD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AMDHD1

Target: AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))

Andere Bezeichnung: AMDHD1

Hintergrund: The function of AMDHD protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 47 kDa (MW of target protein)