KRT222 Antikörper (N-Term)

Produktnummer ABIN632733

Produktdetails anti-KRT222 Antikörper

Target: KRT222 (Keratin 222 (KRT222))

Bindungsspezifität: N-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRT222 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Cytokeratin 222 Pseudogene antibody was raised against the N terminal of KRT222 P

Aufreinigung: Affinity purified

Immunogen: Cytokeratin 222 Pseudogene antibody was raised using the N terminal of KRT222 P corresponding to a region with amino acids ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cytokeratin 222 Pseudogene Blocking Peptide, catalog no. 33R-2575, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 222 Pseudogene antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT220 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KRT222

Target: KRT222 (Keratin 222 (KRT222))

Abstract: KRT222 Produkte

Synonyme: KRT222P antikoerper, KA21 antikoerper, 6330509G02Rik antikoerper, keratin 222 antikoerper, KRT222 antikoerper, Krt222 antikoerper

Hintergrund: KRT222P belongs to the intermediate filament family. The exact function of KRT222P is not known.

Molekulargewicht: 34 kDa (MW of target protein)