LSM12B Antikörper
-
- Target Alle LSM12B Antikörper anzeigen
- LSM12B (LSM12 Homolog B (LSM12B))
-
Reaktivität
- Maus, Ratte, Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LSM12B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- LSM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL
- Top Product
- Discover our top product LSM12B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LSM12 Blocking Peptide, catalog no. 33R-7290, is also available for use as a blocking control in assays to test for specificity of this LSM12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LSM12B (LSM12 Homolog B (LSM12B))
- Andere Bezeichnung
- LSM12 (LSM12B Produkte)
- Synonyme
- 1110032E16Rik antikoerper, 1110059P07 antikoerper, 2600001B17Rik antikoerper, RGD1309441 antikoerper, lsm12 antikoerper, lsm12a antikoerper, wu:fe01f11 antikoerper, zgc:66039 antikoerper, LSM12 antikoerper, PNAS-135 antikoerper, LSM12 homolog antikoerper, LSM12 homolog b antikoerper, Lsm12 antikoerper, lsm12b antikoerper, LSM12 antikoerper
- Hintergrund
- LSM12 belongs to the LSM12 family. The exact function of LSM12 is not known.
- Molekulargewicht
- 22 kDa (MW of target protein)
-