WDR63 Antikörper (Middle Region)

Produktnummer ABIN632728

Produktdetails anti-WDR63 Antikörper

Target: WDR63 (WD Repeat Domain 63 (WDR63))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR63 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR63 antibody was raised against the middle region of WDR63

Aufreinigung: Affinity purified

Immunogen: WDR63 antibody was raised using the middle region of WDR63 corresponding to a region with amino acids EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR63 Blocking Peptide, catalog no. 33R-2463, is also available for use as a blocking control in assays to test for specificity of this WDR63 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR63 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR63

Target: WDR63 (WD Repeat Domain 63 (WDR63))

Andere Bezeichnung: WDR63 (WDR63 Produkte)

Synonyme: DIC3 antikoerper, NYD-SP29 antikoerper, RP11-507C22.2 antikoerper, 4931433A13Rik antikoerper, RGD1563105 antikoerper, WD repeat domain 63 antikoerper, WDR63 antikoerper, Wdr63 antikoerper

Hintergrund: WDR63 contains 5 WD repeats. The exact function of WDR63 is not known.

Molekulargewicht: 103 kDa (MW of target protein)