PACRGL Antikörper (Middle Region)

Produktnummer ABIN632727

Dieses Anti-PACRGL-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PACRGL in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für PACRGL Antikörper (Middle Region) (ABIN632727)

Target: PACRGL (PARK2 Co-Regulated-Like (PACRGL))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PACRGL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PACRGL Antikörper

Bindungsspezifität: Middle Region

Spezifität: C4 ORF28 antibody was raised against the middle region of C4 rf28

Aufreinigung: Affinity purified

Immunogen: C4 ORF28 antibody was raised using the middle region of C4 rf28 corresponding to a region with amino acids PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C4ORF28 Blocking Peptide, (ABIN5612521), is also available for use as a blocking control in assays to test for specificity of this C4ORF28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PACRGL

Target: PACRGL (PARK2 Co-Regulated-Like (PACRGL))

Andere Bezeichnung: C4ORF28

Hintergrund: The function of Chromosome 4 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 24 kDa (MW of target protein)