ARL13B Antikörper (Middle Region)

Produktnummer ABIN632725

Produktdetails anti-ARL13B Antikörper

Target: ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARL13B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARL13 B antibody was raised against the middle region of ARL13

Aufreinigung: Affinity purified

Immunogen: ARL13 B antibody was raised using the middle region of ARL13 corresponding to a region with amino acids VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARL13B Blocking Peptide, catalog no. 33R-9507, is also available for use as a blocking control in assays to test for specificity of this ARL13B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARL13B

Target: ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))

Andere Bezeichnung: ARL13B (ARL13B Produkte)

Synonyme: ARL2L1 antikoerper, MGC185757 antikoerper, arl2l1 antikoerper, chunp6872 antikoerper, fc23g07 antikoerper, wu:fc23g07 antikoerper, zgc:123149 antikoerper, JBTS8 antikoerper, A530097K21Rik antikoerper, A930014M17Rik antikoerper, Arl2l1 antikoerper, C530009C10Rik antikoerper, hnn antikoerper, ADP-ribosylation factor like GTPase 13B antikoerper, ADP ribosylation factor like GTPase 13B antikoerper, ADP-ribosylation factor-like 13b antikoerper, ADP-ribosylation factor-like 13B antikoerper, Arl13b antikoerper, ARL13B antikoerper, arl13b antikoerper

Hintergrund: ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.

Molekulargewicht: 36 kDa (MW of target protein)