JOSD2 Antikörper (N-Term)

Produktnummer ABIN632715

Produktdetails anti-JOSD2 Antikörper

Target: JOSD2 (Josephin Domain Containing 2 (JOSD2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser JOSD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: JOSD2 antibody was raised against the N terminal of JOSD2

Aufreinigung: Affinity purified

Immunogen: JOSD2 antibody was raised using the N terminal of JOSD2 corresponding to a region with amino acids QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

JOSD2 Blocking Peptide, catalog no. 33R-7694, is also available for use as a blocking control in assays to test for specificity of this JOSD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JOSD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu JOSD2

Target: JOSD2 (Josephin Domain Containing 2 (JOSD2))

Andere Bezeichnung: JOSD2 (JOSD2 Produkte)

Synonyme: 1110007C05Rik antikoerper, RGD1307305 antikoerper, zgc:55937 antikoerper, Josephin domain containing 2 antikoerper, Josephin domain containing 2 L homeolog antikoerper, Josd2 antikoerper, josd2.L antikoerper, JOSD2 antikoerper, josd2 antikoerper

Hintergrund: The specific function of JOSD2 is not yet known.

Molekulargewicht: 21 kDa (MW of target protein)