ACOT12 Antikörper (Middle Region)

Produktnummer ABIN632711

Der Kaninchen Polyklonal anti-ACOT12 Antikörper wird verwendet zum Nachweis von ACOT12 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für ACOT12 Antikörper (Middle Region) (ABIN632711)

Target: ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACOT12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACOT12 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ACOT12 antibody was raised against the middle region of ACOT12

Aufreinigung: Affinity purified

Immunogen: ACOT12 antibody was raised using the middle region of ACOT12 corresponding to a region with amino acids SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACOT12 Blocking Peptide, (ABIN5611906), is also available for use as a blocking control in assays to test for specificity of this ACOT12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACOT12

Target: ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))

Andere Bezeichnung: ACOT12

Hintergrund: ACOT12 contains 2 acyl coenzyme A hydrolase domains and 1 START domain. It hydrolyzes acetyl-CoA to acetate and CoA.

Molekulargewicht: 62 kDa (MW of target protein)