DUSP19 Antikörper (C-Term)

Produktnummer ABIN632710

Produktdetails anti-DUSP19 Antikörper

Target: DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DUSP19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DUSP19 antibody was raised against the C terminal of DUSP19

Aufreinigung: Affinity purified

Immunogen: DUSP19 antibody was raised using the C terminal of DUSP19 corresponding to a region with amino acids SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DUSP19 Blocking Peptide, catalog no. 33R-8399, is also available for use as a blocking control in assays to test for specificity of this DUSP19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DUSP19

Target: DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))

Andere Bezeichnung: DUSP19 (DUSP19 Produkte)

Synonyme: Dusp19 antikoerper, skrp1 antikoerper, dusp17 antikoerper, ts-dsp1 antikoerper, MGC85046 antikoerper, si:dkey-237j22.1 antikoerper, DKFZp469B171 antikoerper, DUSP17 antikoerper, LMWDSP3 antikoerper, SKRP1 antikoerper, TS-DSP1 antikoerper, 5930436K22Rik antikoerper, C79103 antikoerper, dual specificity phosphatase 19b antikoerper, dual specificity phosphatase 19 antikoerper, dual specificity phosphatase 19 L homeolog antikoerper, dual specificity phosphatase 19a antikoerper, dusp19b antikoerper, DUSP19 antikoerper, dusp19 antikoerper, dusp19.L antikoerper, dusp19a antikoerper, Dusp19 antikoerper

Hintergrund: DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.

Molekulargewicht: 24 kDa (MW of target protein)