DUSP19 Antikörper (C-Term)

Produktnummer ABIN632710

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DUSP19 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für DUSP19 Antikörper (C-Term) (ABIN632710)

Target: DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DUSP19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DUSP19 Antikörper

Bindungsspezifität: C-Term

Spezifität: DUSP19 antibody was raised against the C terminal of DUSP19

Aufreinigung: Affinity purified

Immunogen: DUSP19 antibody was raised using the C terminal of DUSP19 corresponding to a region with amino acids SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DUSP19 Blocking Peptide, (ABIN5613270), is also available for use as a blocking control in assays to test for specificity of this DUSP19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DUSP19

Target: DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))

Andere Bezeichnung: DUSP19

Hintergrund: DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.

Molekulargewicht: 24 kDa (MW of target protein)