Sialidase 4 Antikörper (N-Term)

Produktnummer ABIN632708

Produktdetails anti-Sialidase 4 Antikörper

Target: Sialidase 4 (NEU4)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Sialidase 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NEU4 antibody was raised against the N terminal of NEU4

Aufreinigung: Affinity purified

Immunogen: NEU4 antibody was raised using the N terminal of NEU4 corresponding to a region with amino acids TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NEU4 Blocking Peptide, catalog no. 33R-9097, is also available for use as a blocking control in assays to test for specificity of this NEU4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEU4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Sialidase 4

Target: Sialidase 4 (NEU4)

Andere Bezeichnung: NEU4 (NEU4 Produkte)

Synonyme: 9330166I04 antikoerper, neuraminidase 4 antikoerper, sialidase 4 antikoerper, NEU4 antikoerper, Neu4 antikoerper

Hintergrund: NEU4 belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.

Molekulargewicht: 53 kDa (MW of target protein)