C20orf160 Antikörper (N-Term)
-
- Target Alle C20orf160 Produkte
- C20orf160 (Chromosome 20 Open Reading Frame 160 (C20orf160))
- Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C20orf160 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C20 ORF160 antibody was raised against the N terminal Of C20 rf160
- Aufreinigung
- Affinity purified
- Immunogen
- C20 ORF160 antibody was raised using the N terminal Of C20 rf160 corresponding to a region with amino acids LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C20ORF160 Blocking Peptide, catalog no. 33R-5492, is also available for use as a blocking control in assays to test for specificity of this C20ORF160 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF160 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C20orf160 (Chromosome 20 Open Reading Frame 160 (C20orf160))
- Andere Bezeichnung
- C20ORF160 (C20orf160 Produkte)
- Hintergrund
- The specific function of C20orf160 is not yet known.
- Molekulargewicht
- 47 kDa (MW of target protein)
-