LRRC42 Antikörper (N-Term)

Produktnummer ABIN632704

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LRRC42 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für LRRC42 Antikörper (N-Term) (ABIN632704)

Target: LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LRRC42 Antikörper

Bindungsspezifität: N-Term

Spezifität: LRRC42 antibody was raised against the N terminal of LRRC42

Aufreinigung: Affinity purified

Immunogen: LRRC42 antibody was raised using the N terminal of LRRC42 corresponding to a region with amino acids LIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC42 Blocking Peptide, (ABIN940429), is also available for use as a blocking control in assays to test for specificity of this LRRC42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC42

Target: LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))

Andere Bezeichnung: LRRC42

Hintergrund: The function of LRRC42 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 48 kDa (MW of target protein)