Acap3 Antikörper (N-Term)

Produktnummer ABIN632702

Produktdetails anti-Acap3 Antikörper

Target: Acap3 (ArfGAP with Coiled-Coil, Ankyrin Repeat and PH Domains 3 (Acap3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Acap3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CENTB5 antibody was raised against the N terminal of CENTB5

Aufreinigung: Affinity purified

Immunogen: CENTB5 antibody was raised using the N terminal of CENTB5 corresponding to a region with amino acids LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CENTB5 Blocking Peptide, catalog no. 33R-5340, is also available for use as a blocking control in assays to test for specificity of this CENTB5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENTB5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Acap3

Target: Acap3 (ArfGAP with Coiled-Coil, Ankyrin Repeat and PH Domains 3 (Acap3))

Andere Bezeichnung: CENTB5 (Acap3 Produkte)

Synonyme: CENTB5 antikoerper, Centb5 antikoerper, Kiaa1716-hp antikoerper, mKIAA1716 antikoerper, ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 antikoerper, arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 antikoerper, ACAP3 antikoerper, LOC100568277 antikoerper, Acap3 antikoerper

Hintergrund: CENTB5 is a GTPase-activating protein for the ADP ribosylation factor family.

Molekulargewicht: 85 kDa (MW of target protein)