Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

Acap3 Antikörper (N-Term)

Acap3 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN632702
$836.98
Zzgl. Versandkosten $45.00
100 μL
Lieferung in 9 bis 11 Werktagen
  • Target Alle Acap3 Antikörper anzeigen
    Acap3 (ArfGAP with Coiled-Coil, Ankyrin Repeat and PH Domains 3 (Acap3))
    Bindungsspezifität
    • 9
    • 9
    • 7
    • 2
    • 1
    • 1
    • 1
    N-Term
    Reaktivität
    • 24
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    Human, Maus
    Wirt
    • 24
    Kaninchen
    Klonalität
    • 24
    Polyklonal
    Konjugat
    • 12
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Dieser Acap3 Antikörper ist unkonjugiert
    Applikation
    • 24
    • 17
    • 15
    • 1
    Western Blotting (WB)
    Spezifität
    CENTB5 antibody was raised against the N terminal of CENTB5
    Aufreinigung
    Affinity purified
    Immunogen
    CENTB5 antibody was raised using the N terminal of CENTB5 corresponding to a region with amino acids LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA
  • Applikationshinweise
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    CENTB5 Blocking Peptide, catalog no. 33R-5340, is also available for use as a blocking control in assays to test for specificity of this CENTB5 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENTB5 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C/-20 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Acap3 (ArfGAP with Coiled-Coil, Ankyrin Repeat and PH Domains 3 (Acap3))
    Andere Bezeichnung
    CENTB5 (Acap3 Produkte)
    Synonyme
    CENTB5, Centb5, Kiaa1716-hp, mKIAA1716, ArfGAP with coiled-coil, ankyrin repeat and PH domains 3, arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3, ACAP3, LOC100568277, Acap3
    Hintergrund
    CENTB5 is a GTPase-activating protein for the ADP ribosylation factor family.
    Molekulargewicht
    85 kDa (MW of target protein)
Sie sind hier:
Kundenservice