LRRC17 Antikörper (Middle Region)

Produktnummer ABIN632693

Produktdetails anti-LRRC17 Antikörper

Target: LRRC17 (Leucine Rich Repeat Containing 17 (LRRC17))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC17 antibody was raised against the middle region of LRRC17

Aufreinigung: Affinity purified

Immunogen: LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC17 Blocking Peptide, catalog no. 33R-10275, is also available for use as a blocking control in assays to test for specificity of this LRRC17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC17

Target: LRRC17 (Leucine Rich Repeat Containing 17 (LRRC17))

Andere Bezeichnung: LRRC17 (LRRC17 Produkte)

Synonyme: P37NB antikoerper, 37kDa antikoerper, 4833425M04Rik antikoerper, 6130400C22Rik antikoerper, P37nb antikoerper, leucine rich repeat containing 17 antikoerper, Lrrc17 antikoerper, LRRC17 antikoerper

Hintergrund: LRRC17 contains 6 LRR (leucine-rich) repeats. The exact function of LRRC17 remains unknown.

Molekulargewicht: 52 kDa (MW of target protein)