Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

LRRC17 Antikörper (Leucine Rich Repeat Containing 17) (Middle Region) Primary Antibody

LRRC17 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN632693
$647.32
Zzgl. Versandkosten $45.00
50 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 9 bis 11 Werktagen
  • Target
    LRRC17
    Bindungsspezifität
    Middle Region
    • 1
    • 1
    • 1
    • 1
    Reaktivität
    Human
    • 5
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Wirt
    Kaninchen
    • 4
    • 1
    Klonalität
    Polyklonal
    • 5
    Applikation
    Western Blotting (WB)
    • 5
    • 1
    Spezifität
    LRRC17 antibody was raised against the middle region of LRRC17
    Aufreinigung
    Affinity purified
    Immunogen
    LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL
  • Applikationshinweise
    WB: 0.5 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    LRRC17 Blocking Peptide, catalog no. 33R-10275, is also available for use as a blocking control in assays to test for specificity of this LRRC17 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC17 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    LRRC17
    Andere Bezeichnung
    LRRC17 (LRRC17 Antibody Abstract)
    Synonyme
    P37NB, 37kDa, 4833425M04Rik, 6130400C22Rik, P37nb, leucine rich repeat containing 17, Lrrc17, LRRC17
    Hintergrund
    LRRC17 contains 6 LRR (leucine-rich) repeats. The exact function of LRRC17 remains unknown.
    Molekulargewicht
    52 kDa (MW of target protein)
Sie sind hier:
help Kundenservice