PPP1R27 Antikörper (Middle Region)

Produktnummer ABIN632687

Produktdetails anti-PPP1R27 Antikörper

Target: PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP1R27 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DYSFIP1 antibody was raised against the middle region of DYSFIP1

Aufreinigung: Affinity purified

Immunogen: DYSFIP1 antibody was raised using the middle region of DYSFIP1 corresponding to a region with amino acids DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DYSFIP1 Blocking Peptide, catalog no. 33R-1976, is also available for use as a blocking control in assays to test for specificity of this DYSFIP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYSFIP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP1R27

Target: PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))

Andere Bezeichnung: DYSFIP1 (PPP1R27 Produkte)

Synonyme: DYSFIP1 antikoerper, 1110033I14Rik antikoerper, Dysfip1 antikoerper, toonin antikoerper, RGD1308861 antikoerper, protein phosphatase 1 regulatory subunit 27 antikoerper, protein phosphatase 1, regulatory subunit 27 antikoerper, PPP1R27 antikoerper, Ppp1r27 antikoerper

Hintergrund: The function of DYSFIP1 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 17 kDa (MW of target protein)