PPP1R27 Antikörper (Middle Region)

Produktnummer ABIN632687

Der Kaninchen Polyklonal anti-PPP1R27 Antikörper wird verwendet zum Nachweis von PPP1R27 in Proben von Human, Ratte und Maus. Er wurde validiert für WB.

Kurzübersicht für PPP1R27 Antikörper (Middle Region) (ABIN632687)

Target: PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP1R27 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PPP1R27 Antikörper

Bindungsspezifität: Middle Region

Spezifität: DYSFIP1 antibody was raised against the middle region of DYSFIP1

Aufreinigung: Affinity purified

Immunogen: DYSFIP1 antibody was raised using the middle region of DYSFIP1 corresponding to a region with amino acids DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DYSFIP1 Blocking Peptide, (ABIN937362), is also available for use as a blocking control in assays to test for specificity of this DYSFIP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYSFIP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP1R27

Target: PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))

Andere Bezeichnung: DYSFIP1

Hintergrund: The function of DYSFIP1 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 17 kDa (MW of target protein)