FAM113A Antikörper (N-Term)

Produktnummer ABIN632679

Dieses Anti-FAM113A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FAM113A in WB. Geeignet für Human und Maus.

Kurzübersicht für FAM113A Antikörper (N-Term) (ABIN632679)

Target: FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM113A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM113A Antikörper

Bindungsspezifität: N-Term

Spezifität: FAM113 A antibody was raised against the N terminal of FAM113

Aufreinigung: Affinity purified

Immunogen: FAM113 A antibody was raised using the N terminal of FAM113 corresponding to a region with amino acids VLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM113A Blocking Peptide, catalog no. 33R-9674, is also available for use as a blocking control in assays to test for specificity of this FAM113A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM113A

Target: FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))

Andere Bezeichnung: FAM113A

Hintergrund: FAM113A is involved in protein binding and hydrolase activity.

Molekulargewicht: 52 kDa (MW of target protein)