TRUB2 Antikörper (N-Term)

Produktnummer ABIN632678

Der Kaninchen Polyklonal Anti-TRUB2-Antikörper wurde für WB validiert. Er ist geeignet, TRUB2 in Proben von Human zu detektieren.

Kurzübersicht für TRUB2 Antikörper (N-Term) (ABIN632678)

Target: TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRUB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRUB2 Antikörper

Bindungsspezifität: N-Term

Spezifität: TRUB2 antibody was raised against the N terminal of TRUB2

Aufreinigung: Affinity purified

Immunogen: TRUB2 antibody was raised using the N terminal of TRUB2 corresponding to a region with amino acids MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRUB2 Blocking Peptide, catalog no. 33R-6072, is also available for use as a blocking control in assays to test for specificity of this TRUB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRUB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRUB2

Target: TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))

Andere Bezeichnung: TRUB2

Hintergrund: Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.

Molekulargewicht: 37 kDa (MW of target protein)