UGP2 Antikörper (N-Term)

Produktnummer ABIN632677

Produktdetails anti-UGP2 Antikörper

Target: UGP2 (UDP-Glucose Pyrophosphorylase 2 (UGP2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGP2 antibody was raised against the N terminal of µgP2

Aufreinigung: Affinity purified

Immunogen: UGP2 antibody was raised using the N terminal of µgP2 corresponding to a region with amino acids TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGP2 Blocking Peptide, catalog no. 33R-9141, is also available for use as a blocking control in assays to test for specificity of this µgP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGP2

Target: UGP2 (UDP-Glucose Pyrophosphorylase 2 (UGP2))

Andere Bezeichnung: UGP2 (UGP2 Produkte)

Synonyme: DDBDRAFT_0204359 antikoerper, DDBDRAFT_0214911 antikoerper, DDB_0204359 antikoerper, DDB_0214911 antikoerper, UDPG antikoerper, UDPGP antikoerper, UDPGP2 antikoerper, UGP1 antikoerper, UGPP1 antikoerper, UGPP2 antikoerper, pHC379 antikoerper, Ugp2 antikoerper, fi53h10 antikoerper, wu:fi53h10 antikoerper, zgc:85662 antikoerper, AtUGP1 antikoerper, T17B22.6 antikoerper, T17B22_6 antikoerper, UDP-GLUCOSE PYROPHOSPHORYLASE 1 antikoerper, UDP-glucose pyrophosphorylase antikoerper, UGP antikoerper, UGPASE antikoerper, UGPase antikoerper, UDP-glucose pyrophosphorylase 2 antikoerper, UDP-glucose pyrophosphorylase 2 L homeolog antikoerper, UDP-glucose pyrophosphorylase 2b antikoerper, UDP-GLUCOSE PYROPHOSPHORYLASE 1 antikoerper, UDP-glucose pyrophosphorylase precursor antikoerper, ugpB antikoerper, ugp2.L antikoerper, UGP2 antikoerper, Ugp2 antikoerper, ugp2b antikoerper, LOAG_08596 antikoerper, DICPUDRAFT_55932 antikoerper, UGP1 antikoerper, LOC102577726 antikoerper

Hintergrund: UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen, in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process