UGP2 Antikörper (N-Term)

Produktnummer ABIN632677

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch UGP2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für UGP2 Antikörper (N-Term) (ABIN632677)

Target: UGP2 (UDP-Glucose Pyrophosphorylase 2 (UGP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UGP2 Antikörper

Bindungsspezifität: N-Term

Spezifität: UGP2 antibody was raised against the N terminal of µgP2

Aufreinigung: Affinity purified

Immunogen: UGP2 antibody was raised using the N terminal of µgP2 corresponding to a region with amino acids TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGP2 Blocking Peptide, (ABIN5616898), is also available for use as a blocking control in assays to test for specificity of this µgP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGP2

Target: UGP2 (UDP-Glucose Pyrophosphorylase 2 (UGP2))

Andere Bezeichnung: UGP2

Hintergrund: UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen, in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process