TNNI3K Antikörper (Middle Region)

Produktnummer ABIN632674

Produktdetails anti-TNNI3K Antikörper

Target: TNNI3K (TNNI3 Interacting Kinase (TNNI3K))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNNI3K Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TNNI3 K antibody was raised against the middle region of TNNI3

Aufreinigung: Affinity purified

Immunogen: TNNI3 K antibody was raised using the middle region of TNNI3 corresponding to a region with amino acids PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TNNI3K Blocking Peptide, catalog no. 33R-7128, is also available for use as a blocking control in assays to test for specificity of this TNNI3K antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNNI3K

Target: TNNI3K (TNNI3 Interacting Kinase (TNNI3K))

Andere Bezeichnung: TNNI3K (TNNI3K Produkte)

Synonyme: CARK antikoerper, Cark antikoerper, D830019J24Rik antikoerper, TNNI3 interacting kinase antikoerper, serine/threonine-protein kinase TNNI3K antikoerper, TNNI3K antikoerper, LOC100592286 antikoerper, Tnni3k antikoerper

Hintergrund: TNNI3K may play a role in cardiac physiology.

Molekulargewicht: 93 kDa (MW of target protein)