FAM82B Antikörper (N-Term)

Produktnummer ABIN632672

Produktdetails anti-FAM82B Antikörper

Target: FAM82B (RMDN1) (Regulator of Microtubule Dynamics 1 (RMDN1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM82B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM82 B antibody was raised against the N terminal of FAM82

Aufreinigung: Affinity purified

Immunogen: FAM82 B antibody was raised using the N terminal of FAM82 corresponding to a region with amino acids MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM82B Blocking Peptide, catalog no. 33R-5682, is also available for use as a blocking control in assays to test for specificity of this FAM82B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM82B

Target: FAM82B (RMDN1) (Regulator of Microtubule Dynamics 1 (RMDN1))

Andere Bezeichnung: FAM82B (RMDN1 Produkte)

Synonyme: Fam82b antikoerper, RMD-1 antikoerper, FAM82B antikoerper, RMD1 antikoerper, fam82b antikoerper, rmdn1 antikoerper, regulator of microtubule dynamics 1 antikoerper, Regulator of microtubule dynamics protein 1 antikoerper, regulator of microtubule dynamics 1 S homeolog antikoerper, Rmdn1 antikoerper, RMDN1 antikoerper, rmd-1 antikoerper, rmdn1.S antikoerper

Hintergrund: The specific function of FAM82B is not yet known.

Molekulargewicht: 36 kDa (MW of target protein)