CHMP1B Antikörper (N-Term)

Produktnummer ABIN632659

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CHMP1B in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CHMP1B Antikörper (N-Term) (ABIN632659)

Target: CHMP1B (Charged Multivesicular Body Protein 1B (CHMP1B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHMP1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHMP1B Antikörper

Bindungsspezifität: N-Term

Spezifität: CHMP1 B antibody was raised against the N terminal of CHMP1

Aufreinigung: Affinity purified

Immunogen: CHMP1 B antibody was raised using the N terminal of CHMP1 corresponding to a region with amino acids KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHMP1B Blocking Peptide, (ABIN939821), is also available for use as a blocking control in assays to test for specificity of this CHMP1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHMP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHMP1B

Target: CHMP1B (Charged Multivesicular Body Protein 1B (CHMP1B))

Andere Bezeichnung: CHMP1B

Hintergrund: CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression.

Molekulargewicht: 22 kDa (MW of target protein)