DCMP Deaminase (DCTD) (Middle Region) Antikörper

Produktnummer ABIN632656

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch DCMP Deaminase in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für DCMP Deaminase (DCTD) (Middle Region) Antikörper (ABIN632656)

Target: DCMP Deaminase (DCTD)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: Middle Region

Spezifität: DCTD antibody was raised against the middle region of DCTD

Aufreinigung: Affinity purified

Immunogen: DCTD antibody was raised using the middle region of DCTD corresponding to a region with amino acids MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DCTD Blocking Peptide, (ABIN5613141), is also available for use as a blocking control in assays to test for specificity of this DCTD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCTD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: DCMP Deaminase (DCTD)

Andere Bezeichnung: DCTD

Hintergrund: The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 21 kDa (MW of target protein)